CacheBy
Atlas Antibodies Anti-WNK2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WNK2 Antibody

상품 한눈에 보기

인간 WNK2 단백질에 특이적인 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 신뢰성 높은 항체. Rabbit 유래 IgG로 PrEST 항원 기반 정제. Human 반응성 검증 완료.

카탈로그번호
HPA016519-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA016519-100 Anti-WNK2 Antibody, WNK lysine deficient protein kinase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA016519-25 Anti-WNK2 Antibody, WNK lysine deficient protein kinase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WNK2 Antibody

Anti-WNK2 Antibody

Target: WNK lysine deficient protein kinase 2
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)
  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human WNK2.


Alternative Gene Names

KIAA1760, NY-CO-43, PRKWNK2, SDCCAG43

Open Datasheet


Antigen Information

  • Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    KHLKEISELQSQQKQEIEALYRRLGKPLPPNVGFFHTAPPTGRRRKTSKSKLKAGKLLNPLVRQLKVVASST

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000037989 97%
Rat ENSRNOG00000016684 97%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.