CacheBy
Atlas Antibodies Anti-WDSUB1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WDSUB1 Antibody

상품 한눈에 보기

인간 WDSUB1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA036840-100 Anti-WDSUB1 Antibody, WD repeat, sterile alpha motif and U-box domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036840-25 Anti-WDSUB1 Antibody, WD repeat, sterile alpha motif and U-box domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WDSUB1 Antibody

Anti-WDSUB1 Antibody

Target: WD repeat, sterile alpha motif and U-box domain containing 1 (WDSUB1)

면역조직화학(IHC) 등 다양한 연구 응용에 적합

Product Description

Polyclonal antibody against human WDSUB1.

Alternative Gene Names

FLJ36175, UBOX6, WDSAM1

Open Datasheet (PDF)

Target Information

  • Protein: WD repeat, sterile alpha motif and U-box domain containing 1
  • Gene: WDSUB1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TTVLWNTENGQMLAVMEQPSGSPVRVCQFSPDSTCLASGAADGTVVLWNAQSYKLYRCGSVKDGSLAACAFSPNGSFFVTGSSCGDLTV

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000005990 78%
Mouse ENSMUSG00000026988 75%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험 목적에 따라 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.