CacheBy
Atlas Antibodies Anti-WDR37 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WDR37 Antibody

상품 한눈에 보기

Human WDR37 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 Western Blot에 적합. PrEST 항원을 이용해 친화 정제되었으며, Human, Mouse, Rat에서 반응 확인. 40% 글리세롤 기반 PBS 버퍼에 보존제 포함.

카탈로그번호
HPA037565-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037565-100 Anti-WDR37 Antibody, WD repeat domain 37 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037565-25 Anti-WDR37 Antibody, WD repeat domain 37 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WDR37 Antibody

Anti-WDR37 Antibody

WD repeat domain 37

  • Immunohistochemistry (IHC) – Independent antibody validation
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human WDR37

Alternative Gene Names

  • KIAA0982

Open Datasheet

Target Information

항목 내용
Target Protein WD repeat domain 37
Target Gene WDR37
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
FRDPSIHSVNVFQGHTDTVTSAVFTVGDNVVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRINVCVGQKIIALPHDNRQVRLFDMSGVRLARLPRSSRQGHRRMVCCS

Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000016834 (100%)
  • Mouse ENSMUSG00000021147 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Tooltip Independent Validation
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.