
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-WDR37 Antibody
상품 한눈에 보기
Human WDR37 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 Western Blot에 적합. PrEST 항원을 이용해 친화 정제되었으며, Human, Mouse, Rat에서 반응 확인. 40% 글리세롤 기반 PBS 버퍼에 보존제 포함.
- 카탈로그번호
- HPA037565-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA037565-100 Anti-WDR37 Antibody, WD repeat domain 37 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037565-25 Anti-WDR37 Antibody, WD repeat domain 37 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-WDR37 Antibody
Anti-WDR37 Antibody
WD repeat domain 37
Recommended Applications
- Immunohistochemistry (IHC) – Independent antibody validation
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - Western Blot (WB)
Product Description
Polyclonal Antibody against Human WDR37
Alternative Gene Names
- KIAA0982
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | WD repeat domain 37 |
| Target Gene | WDR37 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: FRDPSIHSVNVFQGHTDTVTSAVFTVGDNVVSGSDDRTVKVWDLKNMRSPIATIRTDSAINRINVCVGQKIIALPHDNRQVRLFDMSGVRLARLPRSSRQGHRRMVCCS |
Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000016834 (100%)
- Mouse ENSMUSG00000021147 (100%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



