CacheBy
Atlas Antibodies Anti-WDR27 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WDR27 Antibody

상품 한눈에 보기

Human WDR27 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤/PBS 완충액에 보존됩니다. 인간에 대한 반응성이 검증되었습니다.

카탈로그번호
HPA037498-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037498-100 Anti-WDR27 Antibody, WD repeat domain 27 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037498-25 Anti-WDR27 Antibody, WD repeat domain 27 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WDR27 Antibody

Anti-WDR27 Antibody

Target: WD repeat domain 27 (WDR27)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human WDR27 protein.

Alternative Gene Names

  • MGC43690

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein WD repeat domain 27
Target Gene WDR27
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence SCALRNRTADQKVLCLLASLFGGKIAVLEINPAALVRAQQCPSMGQSLSVPASSCVLPTSPLYLGIAKEKSTKAASEQRRAARNVMKDQR
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000015609 (54%), Mouse ENSMUSG00000046991 (53%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.