CacheBy
Atlas Antibodies Anti-WBSCR27 Antibody
원본

Atlas Antibodies Anti-WBSCR27 Antibody

상품 한눈에 보기

인간 WBSCR27 단백질에 대한 고품질 폴리클로날 항체. Rabbit 유래 IgG로 IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 정제된 고특이성 항체. PBS/glycerol buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA022420-100 Anti-WBSCR27 Antibody, Williams Beuren syndrome chromosome region 27 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA022420-25 Anti-WBSCR27 Antibody, Williams Beuren syndrome chromosome region 27 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WBSCR27 Antibody

Anti-WBSCR27 Antibody

Target: Williams Beuren syndrome chromosome region 27
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human WBSCR27.

Open Datasheet


Target Information

항목 내용
Target Protein Williams Beuren syndrome chromosome region 27
Target Gene WBSCR27
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LTTRTNSSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWRWYPASLPRMASSPALSTCTESG
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000046700 (41%), Mouse ENSMUSG00000040557 (39%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Safety Data Material Safety Data Sheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.