CacheBy
Atlas Antibodies Anti-VWA8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VWA8 Antibody

상품 한눈에 보기

인체 VWA8 단백질을 표적으로 하는 폴리클로날 항체로, WB 및 ICC에 적합합니다. Rabbit 호스트에서 생산되었으며 IgG 아이소타입을 가집니다. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA039075-100 Anti-VWA8 Antibody, von Willebrand factor A domain containing 8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039075-25 Anti-VWA8 Antibody, von Willebrand factor A domain containing 8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VWA8 Antibody

Anti-VWA8 Antibody

Target Information

  • Target Protein: von Willebrand factor A domain containing 8
  • Target Gene: VWA8
  • Alternative Gene Names: KIAA0564
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human VWA8.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

EHAIKEIVKEEADEYFVIVLSDANLSRYGIHPAKFAQILTRDPQVNAFAIFIGSLGDQATRLQRTLPAGRSFVAMDTKDIPQILQQIFTSTML

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000058997 (89%)
  • Rat ENSRNOG00000025522 (25%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Storage Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Additional Information

제품 이미지

WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.