CacheBy
Atlas Antibodies Anti-VTN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VTN Antibody

상품 한눈에 보기

Human vitronectin(VTN)을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인체 반응성이 검증되었으며, 40% 글리세롤과 PBS 완충액에 보존됩니다.

카탈로그번호
HPA068011-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA068011-100 Anti-VTN Antibody, vitronectin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068011-25 Anti-VTN Antibody, vitronectin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VTN Antibody

Anti-VTN Antibody

Target Information

  • Target Protein: Vitronectin
  • Target Gene: VTN
  • Alternative Gene Names: VN

Product Description

Polyclonal antibody against human vitronectin (VTN).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KCQCDELCSYYQSCCTDYTAECKPQVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000010031 58%
Mouse ENSMUSG00000017344 58%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.