CacheBy
Atlas Antibodies Anti-VPS13B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VPS13B Antibody

상품 한눈에 보기

인간 VPS13B 단백질에 대한 고특이적 폴리클로날 항체로, WB 및 ICC에 적합합니다. Affinity purification으로 높은 순도 확보. Rabbit IgG 포맷이며, 안정화용 glycerol 및 sodium azide 포함. 인간 대상 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043865-100 Anti-VPS13B Antibody, vacuolar protein sorting 13 homolog B (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043865-25 Anti-VPS13B Antibody, vacuolar protein sorting 13 homolog B (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VPS13B Antibody

Anti-VPS13B Antibody

Target: vacuolar protein sorting 13 homolog B (yeast)

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human VPS13B.

Alternative Gene Names

  • CHS1
  • COH1

Open Datasheet

Target Information

항목 내용
Target Protein vacuolar protein sorting 13 homolog B (yeast)
Target Gene VPS13B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000037646 (83%), Rat ENSRNOG00000057443 (27%)

Antigen Sequence:

PSVIKIHTLVESLKLSITDQQLPMFIRIMQLGIALYYGEIGNFKEGEIEDLTCHNKDMLGNITGSEDETR

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Glycerol 40%
PBS pH 7.2
Sodium Azide 0.02% (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.