CacheBy
Atlas Antibodies Anti-VIPR2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VIPR2 Antibody

상품 한눈에 보기

사람 VIPR2 단백질을 인식하는 토끼 폴리클로날 항체로, VPAC2/VPAC2R로도 알려진 vasoactive intestinal peptide receptor 2를 검출합니다. IHC 등 다양한 응용에 적합하며, 프레스티지 항원 기반 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062707-100 Anti-VIPR2 Antibody, vasoactive intestinal peptide receptor 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062707-25 Anti-VIPR2 Antibody, vasoactive intestinal peptide receptor 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VIPR2 Antibody

Anti-VIPR2 Antibody

Target: vasoactive intestinal peptide receptor 2 (VIPR2)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human VIPR2 (vasoactive intestinal peptide receptor 2).


Alternative Gene Names

  • VPAC2
  • VPAC2R

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein vasoactive intestinal peptide receptor 2
Target Gene VIPR2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWR

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

유전자 ID 서열 동일도
Rat ENSRNOG00000004317 89%
Mouse ENSMUSG00000011171 89%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.