CacheBy
Atlas Antibodies Anti-VGF Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VGF Antibody

상품 한눈에 보기

인간 VGF 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. Rabbit 유래 IgG 항체이며 PrEST 항원을 이용해 친화 정제되었습니다. PBS/glycerol 버퍼에 보존되어 다양한 조직 발현 분석에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA072505-100 Anti-VGF Antibody, VGF nerve growth factor inducible 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA072505-25 Anti-VGF Antibody, VGF nerve growth factor inducible 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VGF Antibody

Anti-VGF Antibody

VGF nerve growth factor inducible

  • IHC (Orthogonal validation)
  • ICC

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human VGF

Open Datasheet

Target Information

항목 내용
Target Protein VGF nerve growth factor inducible
Target Gene VGF
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000037428 (90%), Rat ENSRNOG00000001416 (89%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

APARDELPDWNEVLPPWDREEDEVYPPGPYHPFPNYIRPRTLQPPSALRRRHYHHALPPSRHYPGREAQARRAQEEAEAEERRLQEQEELENYIEHV

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.