CacheBy
Atlas Antibodies Anti-VAT1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VAT1 Antibody

상품 한눈에 보기

Human VAT1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 Western Blot에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤 및 PBS 완충액에 보존제로 sodium azide를 포함합니다.

카탈로그번호
HPA045170-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045170-100 Anti-VAT1 Antibody, vesicle amine transport 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045170-25 Anti-VAT1 Antibody, vesicle amine transport 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VAT1 Antibody

Anti-VAT1 Antibody

Target: Vesicle Amine Transport 1 (VAT1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human VAT1.


Alternative Gene Names

FLJ20230, VATI

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Vesicle amine transport 1
Target Gene VAT1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GDRVMVLNRSGMWQEEVTVPSVQTFLIPEAMTFEEAAALLVNYITAYMVLFDFGNLQPGHSVLVH

Species Reactivity

Verified species: Human

Interspecies Information:
Highest antigen sequence identity to orthologs:

  • Mouse (ENSMUSG00000034993): 95%
  • Rat (ENSRNOG00000020684): 95%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.