
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-VAT1L Antibody
상품 한눈에 보기
Human VAT1L 단백질을 인식하는 폴리클로날 항체로, Recombinant expression 기반 WB 및 ICC 검증 완료. Rabbit 유래 IgG, Affinity purification 방식 사용. Human에 대한 높은 특이성 및 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA061138-100 Anti-VAT1L Antibody, vesicle amine transport 1 like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061138-25 Anti-VAT1L Antibody, vesicle amine transport 1 like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-VAT1L Antibody
Anti-VAT1L Antibody
Target: Vesicle amine transport 1-like (VAT1L)
Type: Polyclonal Antibody against Human VAT1L
Recommended Applications
- WB (Recombinant expression validation using target protein overexpression)
- ICC
Alternative Gene Names
- KIAA1576
Antigen Information
Sequence:
DNPPKTPLVPGFECSGIVEALGDSVKGYEIGDRVMAFVNYNAWAEVVCTPVEFVYKIPDDMSFSEAAAFPMNFVTAYVMLFEVANL
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000046844 | 98% |
| Rat | ENSRNOG00000011989 | 98% |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet (MSDS)
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



