Atlas Antibodies Anti-VAT1L Antibody

상품 한눈에 보기

Human VAT1L 단백질을 인식하는 폴리클로날 항체로, Recombinant expression 기반 WB 및 ICC 검증 완료. Rabbit 유래 IgG, Affinity purification 방식 사용. Human에 대한 높은 특이성 및 재현성 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA061138-100 Anti-VAT1L Antibody, vesicle amine transport 1 like 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA061138-25 Anti-VAT1L Antibody, vesicle amine transport 1 like 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-VAT1L Antibody

Anti-VAT1L Antibody

Target: Vesicle amine transport 1-like (VAT1L)
Type: Polyclonal Antibody against Human VAT1L

Recommended Applications

WB (Recombinant expression validation using target protein overexpression)
ICC

Alternative Gene Names

KIAA1576

Open Datasheet (PDF)

Antigen Information

Sequence:
DNPPKTPLVPGFECSGIVEALGDSVKGYEIGDRVMAFVNYNAWAEVVCTPVEFVYKIPDDMSFSEAAAFPMNFVTAYVMLFEVANL
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Verified Species Reactivity

Human

Interspecies Information

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000046844	98%
Rat	ENSRNOG00000011989	98%

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.