CacheBy
Atlas Antibodies Anti-UXS1 Antibody
원본

Atlas Antibodies Anti-UXS1 Antibody

상품 한눈에 보기

Human UXS1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원으로 특이적 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA008825-100 Anti-UXS1 Antibody, UDP-glucuronate decarboxylase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008825-25 Anti-UXS1 Antibody, UDP-glucuronate decarboxylase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UXS1 Antibody

Anti-UXS1 Antibody

Target Information

  • Target Protein: UDP-glucuronate decarboxylase 1
  • Target Gene: UXS1
  • Alternative Gene Names: FLJ23591, SDR6E1, UGD
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human UXS1, raised in rabbit and affinity purified using the PrEST antigen.

Antigen Information

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

MRSIQENGELKIESKIEEMVEPLREKIRDLEKSFTQKYPPVKFLSEKDRKRILITGGAGFVGSHLTDKLMMDGHEVTVVDNFFTGRKRNVEHWIGHENFELINHDV

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000057363 99%
Rat ENSRNOG00000045605 98%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.