CacheBy
Atlas Antibodies Anti-UTP3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UTP3 Antibody

상품 한눈에 보기

Human UTP3 단백질을 인식하는 고품질 폴리클론 항체로, IHC 및 ICC 분석에 적합합니다. Rabbit에서 생성된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에서 검증된 반응성을 가지며, 40% glycerol PBS buffer로 안정화되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041453-100 Anti-UTP3 Antibody, UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041453-25 Anti-UTP3 Antibody, UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UTP3 Antibody

Anti-UTP3 Antibody

UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human UTP3

Alternative Gene Names

CRLZ1, DKFZp761F222, FLJ23256, SAS10

Open Datasheet

Target Information

항목 내용
Target Protein UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae)
Target Gene UTP3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (95%), Mouse (90%)

Antigen Sequence

LQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQ

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.