CacheBy
Atlas Antibodies Anti-USPL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-USPL1 Antibody

상품 한눈에 보기

인간 USPL1 단백질을 인식하는 폴리클로날 항체로, 면역조직화학(IHC) 등 다양한 응용에 적합함. 토끼에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제됨. PBS와 글리세롤 버퍼에 보존제로 나트륨 아지드 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040172-100 Anti-USPL1 Antibody, ubiquitin specific peptidase like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040172-25 Anti-USPL1 Antibody, ubiquitin specific peptidase like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-USPL1 Antibody

Anti-USPL1 Antibody

Target: ubiquitin specific peptidase like 1 (USPL1)
Supplier: Atlas Antibodies

면역조직화학 (IHC)

Product Description

Polyclonal antibody against human USPL1.

Alternative Gene Names

bA121O19.1, C13orf22, D13S106E

Open Datasheet (PDF)

Target Information

  • Target Protein: ubiquitin specific peptidase like 1
  • Target Gene: USPL1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

YCPACREKGKLKALKTYRISFQESIFLCEDLQCIYPLGSKSLNNLISPDLEECHTPHKPQKRKSLESSYKDSLLLANSKKTRNYIAIDGGKVLNSKHNGEVYDETSSNLPDSSGQQNP

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000041264 (64%)
  • Rat ENSRNOG00000000909 (64%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Notes Gently mix before use. Determine optimal conditions for each application.

Material Safety Data Sheet (Sodium Azide)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.