CacheBy
Atlas Antibodies Anti-USP18 Antibody
원본

Atlas Antibodies Anti-USP18 Antibody

상품 한눈에 보기

Human USP18 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 PBS 버퍼에 보존됩니다. 인체 반응성이 검증되어 연구용으로 신뢰성 높습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044768-100 Anti-USP18 Antibody, ubiquitin specific peptidase 18 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044768-25 Anti-USP18 Antibody, ubiquitin specific peptidase 18 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-USP18 Antibody

Anti-USP18 Antibody

Target: Ubiquitin specific peptidase 18 (USP18)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human USP18 (ubiquitin specific peptidase 18).
This antibody is affinity purified using the PrEST antigen as an affinity ligand.

Open Datasheet (PDF)


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    AESSQSPADLEEKKEEDSNMKREQPRERPRAWDYPHGLVGLHNI

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000037198 43%
Mouse ENSMUSG00000030107 41%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.