Atlas Antibodies Anti-USP10 Antibody

상품 한눈에 보기

인간 USP10 단백질을 인식하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용 분야에 적합. siRNA knockdown을 통한 유전적 검증 및 독립 항체 비교 검증 완료. 친화성 정제된 토끼 IgG 포맷으로 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA006731-100 Anti-USP10 Antibody, ubiquitin specific peptidase 10 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA006731-25 Anti-USP10 Antibody, ubiquitin specific peptidase 10 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Ubiquitin specific peptidase 10 (USP10)
Supplier: Atlas Antibodies

IHC Independent Validation: Validation of protein expression in immunohistochemistry (IHC) by comparing independent antibodies targeting different epitopes of the protein.
WB Genetic Validation: Genetic validation in Western blot (WB) by siRNA knockdown.
ICC: Immunocytochemistry (ICC) compatible.

Polyclonal antibody against Human USP10.

KIAA0190, UBPO

항목	내용
Target Protein	Ubiquitin specific peptidase 10
Target Gene	USP10
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	KITPDGITKEASYGSIDCQYPGSALALDGSSNVEAEVLENDGVSGGLGQRERKKKKKRPPGYYSYLKDGGDDSISTEALVNGHANSAVPNSVSAEDAEFMGDMPPPLTPRTCNSPQNSTDS
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000016509 (67%), Mouse ENSMUSG00000031826 (64%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand