CacheBy
Atlas Antibodies Anti-USH1G Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-USH1G Antibody

상품 한눈에 보기

Human USH1G 단백질을 인식하는 Rabbit Polyclonal Antibody로, Usher syndrome 1G 연구에 적합함. Affinity purification 방식으로 제조되어 높은 특이성과 재현성을 제공. IHC 등 다양한 응용에 사용 가능. PBS 기반 buffer와 sodium azide 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024360-100 Anti-USH1G Antibody, Usher syndrome 1G (autosomal recessive) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024360-25 Anti-USH1G Antibody, Usher syndrome 1G (autosomal recessive) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-USH1G Antibody

Anti-USH1G Antibody

Target Information

  • Target Protein: Usher syndrome 1G (autosomal recessive)
  • Target Gene: USH1G
  • Alternative Gene Names: ANKS4A, FLJ33924, Sans

Product Description

Polyclonal Antibody against Human USH1G.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

NIWCLDNDYHTPLDMAAMKGHMECVRYLDSIAAKQSSLNPKLVGKLKDKAFREAERRIRECAKLQRRHHERMER

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000045288 (97%)
  • Rat ENSRNOG00000028456 (97%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Immunohistochemistry (IHC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.