
원본
Thermo Fisher Scientific CHERP Polyclonal Antibody, FITC
상품 한눈에 보기
CHERP 단백질을 인식하는 FITC 결합 토끼 다클론 항체로, Western blot, IHC, ICC, ELISA 등 다양한 응용에 적합합니다. 인간, 마우스, 랫트 등에서 반응하며, 형광 검출용으로 사용됩니다. 연구용으로만 사용 가능합니다.
- 카탈로그번호
- CHRP-FITC
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오전 09:08
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific CHRP-FITC CHERP Polyclonal Antibody, FITC 200 ul pk판매 단위 pk ·
재고 확인 필요
594,400원VAT 포함 653,840원
Thermo Fisher Scientific · Thermo Fisher Scientific CHERP Polyclonal Antibody, FITC
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:1,000 |
| Immunohistochemistry (IHC) | 1:50–1:250 |
| Immunocytochemistry (ICC/IF) | 1:50–1:250 |
| ELISA | 1:10,000 |
| Immunoprecipitation (IP) | 1:50–1:250 |
| Immunomicroscopy (IM) | 1:50–1:200 |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Non-human primate, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a region within internal sequence amino acids 846–913 of human CHERP (Sequence: EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD) |
| Conjugate | FITC (Fluorescein isothiocyanate) |
| Excitation / Emission Max | 498 / 517 nm |
| Form | Liquid |
| Concentration | 0.5–1.5 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | Proprietary buffer, pH 7.4–7.8, with 0.5% BSA, 30% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | –20°C, store in dark |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Target Information
CHERP (Calcium Homeostasis Endoplasmic Reticulum Protein) is involved in calcium homeostasis, growth, and proliferation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지

Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.

