Atlas Antibodies Anti-UPK1B Antibody

상품 한눈에 보기

Human UPK1B 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 및 RNA-seq 데이터 비교를 통한 Orthogonal 검증을 거침. 고순도 Affinity 정제 방식으로 제조되어 높은 특이성과 재현성을 제공. 인체 UPK1B 연구 및 단백질 발현 분석에 적합.

카탈로그번호: HPA031800-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA031800-100 Anti-UPK1B Antibody, uroplakin 1B 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA031800-25 Anti-UPK1B Antibody, uroplakin 1B 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-UPK1B Antibody

Anti-UPK1B Antibody

Target Protein: uroplakin 1B
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human UPK1B

Alternative Gene Names

TSPAN20, UPK1

Open Datasheet

Specifications

항목	내용
Target Protein	uroplakin 1B
Target Gene	UPK1B
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	FTPNLFLKQMLERYQNNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDW
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000049436 (91%), Rat ENSRNOG00000027380 (87%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.