Atlas Antibodies Anti-UPK2 Antibody

상품 한눈에 보기

인체 UPK2 단백질을 표적으로 하는 폴리클로날 항체로, 면역조직화학(IHC) 검증을 통해 RNA-seq 데이터와 비교된 정교한 Orthogonal Validation을 제공. 토끼에서 생산된 IgG 항체이며, 친화 정제 방식으로 높은 특이성과 재현성을 보장. Human에 반응하며 연구용으로 적합.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA061106-100 Anti-UPK2 Antibody, uroplakin 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA061106-25 Anti-UPK2 Antibody, uroplakin 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-UPK2 Antibody

Anti-UPK2 Antibody

Target Protein: uroplakin 2
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human UPK2.

Alternative Gene Names

MGC138598, UP2, UPII

Open Datasheet

Specifications

항목	내용
Target Protein	uroplakin 2
Target Gene	UPK2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	ISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKVVTSSFVVPPCRGRRELVS
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000041523 (95%), Rat ENSRNOG00000043324 (95%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.