CacheBy
Atlas Antibodies Anti-UNC119 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UNC119 Antibody

상품 한눈에 보기

Human UNC119 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증에 적합. Rabbit 유래 IgG 항체이며, 고순도 친화 정제 방식으로 제조. HRG4, POC7 등 대체 유전자명과 높은 종간 서열 동일성을 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041912-100 Anti-UNC119 Antibody, unc-119 homolog (C. elegans) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041912-25 Anti-UNC119 Antibody, unc-119 homolog (C. elegans) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UNC119 Antibody

Anti-UNC119 Antibody

unc-119 homolog (C. elegans)


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Recombinant Expression)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal Antibody against Human UNC119


Alternative Gene Names

HRG4, POC7, POC7A

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein unc-119 homolog (C. elegans)
Target Gene UNC119
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKI

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000011060 (98%)
  • Mouse ENSMUSG00000002058 (98%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Glycerol 40%
PBS pH 7.2
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.