CacheBy
Atlas Antibodies Anti-UGDH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UGDH Antibody

상품 한눈에 보기

Human UGDH 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 독립 항체 및 RNA-seq 기반 정교한 검증을 거쳤으며, 고순도의 Affinity 정제 항체입니다. Human, Mouse, Rat에 반응합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036657-100 Anti-UGDH Antibody, UDP-glucose 6-dehydrogenase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036657-25 Anti-UGDH Antibody, UDP-glucose 6-dehydrogenase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UGDH Antibody

Anti-UGDH Antibody

Target: UDP-glucose 6-dehydrogenase (UGDH)
Supplier: Atlas Antibodies


  • IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Orthogonal Validation): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody against human UGDH.
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein UDP-glucose 6-dehydrogenase
Target Gene UGDH
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence AVVICTEWDMFKELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIPKFSLQDPPNKKPKV

Reactivity

항목 내용
Verified Species Reactivity Human, Mouse, Rat
Interspecies Information Mouse ENSMUSG00000029201 (95%), Rat ENSRNOG00000002643 (95%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Independent Validation
WB Orthogonal Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.