Atlas Antibodies Anti-UCMA Antibody

상품 한눈에 보기

Human UCMA 단백질을 표적으로 하는 폴리클로날 항체로, 성장판 상부 영역 및 연골 기질 관련 단백질 연구에 적합합니다. Rabbit에서 생산된 IgG 형 항체이며, Affinity purified 방식으로 정제되었습니다. IHC 등 다양한 응용에 권장됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA046718-100 Anti-UCMA Antibody, upper zone of growth plate and cartilage matrix associated 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA046718-25 Anti-UCMA Antibody, upper zone of growth plate and cartilage matrix associated 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Human UCMA 단백질(upper zone of growth plate and cartilage matrix associated)을 표적으로 하는 폴리클로날 항체입니다.

Polyclonal Antibody against Human UCMA

항목	내용
Target Protein	Upper zone of growth plate and cartilage matrix associated
Target Gene	UCMA
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000026668 (88%), Rat ENSRNOG00000017987 (88%)

Antigen Sequence:
YYEEQRNEFENFVEEQNDEQEERSREAVEQWRQWHYDGLHPSYLYNRHHT

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand