Atlas Antibodies Anti-UBE2C Antibody

상품 한눈에 보기

Human UBE2C 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 40% 글리세롤 및 PBS 완충액에 보존제가 포함되어 안정적. Rat 및 Mouse와 교차 반응성이 높음.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA054975-100 Anti-UBE2C Antibody, ubiquitin-conjugating enzyme E2C 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA054975-25 Anti-UBE2C Antibody, ubiquitin-conjugating enzyme E2C 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: ubiquitin-conjugating enzyme E2C
Type: Polyclonal Antibody against Human UBE2C (UBCH10)

Polyclonal antibody raised in rabbit against the human UBE2C protein, also known as ubiquitin-conjugating enzyme E2C.

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVD

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000015131	100%
Mouse	ENSMUSG00000001403	98%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)