CacheBy
Atlas Antibodies Anti-UAP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UAP1 Antibody

상품 한눈에 보기

Human UAP1 단백질을 인식하는 고품질 Rabbit Polyclonal 항체. IHC, WB, ICC 등 다양한 응용에 적합. siRNA 노크다운을 통한 유전적 검증 완료. Affinity purification으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014659-100 Anti-UAP1 Antibody, UDP-N-acetylglucosamine pyrophosphorylase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014659-25 Anti-UAP1 Antibody, UDP-N-acetylglucosamine pyrophosphorylase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UAP1 Antibody

Anti-UAP1 Antibody

Target Protein: UDP-N-acetylglucosamine pyrophosphorylase 1
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Genetic validation by siRNA knockdown
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human UAP1.

Alternative Gene Names: AgX, AGX1, SPAG2
Open Datasheet


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

NDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQAMNFEELNFFFQKAIEGFNQSSHQKNVDARMEPVPREVLGSATRDQDQLQAWESEGLFQISQNKVAVLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQAERILKLQQ

Verified Species Reactivity

  • Human

Interspecies Information:

  • Mouse (ENSMUSG00000026670): 87% identity
  • Rat (ENSRNOG00000002926): 85% identity

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet


제품 이미지

Enhanced Validation
IHC Application
WB Genetic Validation
Genetic Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.