CacheBy
Atlas Antibodies Anti-TYR Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TYR Antibody

상품 한눈에 보기

Human TYR 단백질을 인식하는 토끼 폴리클로날 항체로, 티로시나아제 연구용으로 적합합니다. Affinity purified 방식으로 정제되었으며, ICC 등 다양한 응용에 사용 가능합니다. OCA1 관련 연구에도 활용됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050889-100 Anti-TYR Antibody, tyrosinase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050889-25 Anti-TYR Antibody, tyrosinase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TYR Antibody

Anti-TYR Antibody

Target Information

  • Target Protein: Tyrosinase
  • Target Gene: TYR
  • Alternative Gene Names: OCA1, OCA1A, OCAIA
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TYR (Tyrosinase).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

APIGHNRESYMVPFIPLYRNGDFFISSKDLGYDYSYLQDSDPDSFQDYIKSYLEQASRI

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000016421 (86%)
  • Mouse ENSMUSG00000004651 (83%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Reference Documents

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.