CacheBy
Atlas Antibodies Anti-TYMP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TYMP Antibody

상품 한눈에 보기

Human TYMP 단백질을 인식하는 폴리클로날 항체로, WB 및 ICC 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었습니다. Rabbit 호스트에서 생산되었으며, Affinity purification 방식으로 정제되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001072-100 Anti-TYMP Antibody, thymidine phosphorylase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001072-25 Anti-TYMP Antibody, thymidine phosphorylase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TYMP Antibody

Anti-TYMP Antibody

Target: thymidine phosphorylase (TYMP)
Supplier: Atlas Antibodies

  • Western Blot (WB)
  • Immunocytochemistry (ICC)
  • Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Product Description

Polyclonal Antibody against Human TYMP

Alternative Gene Names

  • ECGF1
  • MNGIE

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein thymidine phosphorylase
Target Gene TYMP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence EGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISG
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000032394 (78%)
Mouse ENSMUSG00000022615 (77%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.