CacheBy
Atlas Antibodies Anti-TTYH3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TTYH3 Antibody

상품 한눈에 보기

Human TTYH3 단백질을 인식하는 rabbit polyclonal antibody로, IHC 등 다양한 응용에 적합함. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 가짐. 40% glycerol/PBS buffer에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA053520-100 Anti-TTYH3 Antibody, tweety family member 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053520-25 Anti-TTYH3 Antibody, tweety family member 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TTYH3 Antibody

Anti-TTYH3 Antibody

Target Information

  • Target Protein: Tweety family member 3
  • Target Gene: TTYH3
  • Alternative Gene Names: KIAA1691

Product Description

Polyclonal antibody against human TTYH3, generated in rabbit and affinity purified using the PrEST antigen as ligand.

  • Immunohistochemistry (IHC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    PWWVSLLHRLPHFDLSWEATSSQFRPEDTDYQQ

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000036565 (94%)
  • Rat ENSRNOG00000055583 (94%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.