
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TTPAL Antibody
상품 한눈에 보기
Human TTPAL 단백질을 인식하는 토코페롤(alpha) 전달 단백질 유사체 항체. Rabbit polyclonal IgG로 제작되었으며, IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원을 이용한 친화 정제 방식 적용. Human에 대해 검증된 반응성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA066532-100 Anti-TTPAL Antibody, tocopherol (alpha) transfer protein-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066532-25 Anti-TTPAL Antibody, tocopherol (alpha) transfer protein-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TTPAL Antibody
Anti-TTPAL Antibody
Target: tocopherol (alpha) transfer protein-like
Type: Polyclonal Antibody against Human TTPAL
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human TTPAL, designed for detection of tocopherol (alpha) transfer protein-like.
Alternative Gene Names
C20orf121, dJ179M20.3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | tocopherol (alpha) transfer protein-like |
| Target Gene | TTPAL |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ARKFDYDRALQLLVNYHSCRRSWPEVFNNLKPSALKDVLASGFLTVLPHTDPRGCHVVCIRPDRWIPSNYPITENIRAIYLTLE |
| Verified Species Reactivity | Human |
| Ortholog Identity | Rat ENSRNOG00000009076 (94%), Mouse ENSMUSG00000017679 (93%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 적합한 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



