AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TTLL9 Antibody
상품 한눈에 보기
Human TTLL9 단백질을 인식하는 Rabbit Polyclonal 항체로, tubulin tyrosine ligase-like family member 9을 타깃으로 함. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. Human에 반응하며, 안정화용 글리세롤 및 방부제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041772-100 Anti-TTLL9 Antibody, tubulin tyrosine ligase-like family, member 9 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041772-25 Anti-TTLL9 Antibody, tubulin tyrosine ligase-like family, member 9 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TTLL9 Antibody
Anti-TTLL9 Antibody
Target: tubulin tyrosine ligase-like family, member 9 (TTLL9)
Supplier: Atlas Antibodies
Recommended Applications
IHC (Immunohistochemistry)
Product Description
Polyclonal antibody against Human TTLL9.
Alternative Gene Names
C20orf125, dJ310O13.1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | tubulin tyrosine ligase-like family, member 9 |
| Target Gene | TTLL9 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GITWIMKPVARSQGKGIFLFRRLKDIVDWRKDTRSSDDQKDDIPVENYVAQRYIE |
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000074673 (95%)
- Rat ENSRNOG00000008596 (66%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.