Atlas Antibodies Anti-TTC5 Antibody

상품 한눈에 보기

Human TTC5 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human에 반응하며 Rat, Mouse와 높은 서열 유사성 보유.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA045008-100 Anti-TTC5 Antibody, tetratricopeptide repeat domain 5 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA045008-25 Anti-TTC5 Antibody, tetratricopeptide repeat domain 5 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: tetratricopeptide repeat domain 5 (TTC5)
Supplier: Atlas Antibodies

면역조직화학(IHC) 등 다양한 연구용 응용에 추천됩니다.

(이미지 OCR 텍스트: IHC recommended)

Polyclonal antibody against human TTC5.

항목	내용
Target Protein	tetratricopeptide repeat domain 5
Target Gene	TTC5
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	GALTHCRNKVSLQNLSMVLRQLRTDTEDEHSHHVMDSVRQAKLAVQMDVHDGRSWYILGNSYLSLYFSTGQNPKISQQALSAYAQAEKVDRKASSNPDL

Highest antigen sequence identity to orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand