
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TTC39C Antibody
상품 한눈에 보기
Human TTC39C 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC 응용에 적합. PrEST 항원으로 친화 정제됨. 높은 종 간 보존성(마우스 98%, 랫 96%)을 보임. 40% 글리세롤/PBS 완충액에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA065713-100 Anti-TTC39C Antibody, tetratricopeptide repeat domain 39C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065713-25 Anti-TTC39C Antibody, tetratricopeptide repeat domain 39C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TTC39C Antibody
Anti-TTC39C Antibody
Target: tetratricopeptide repeat domain 39C (TTC39C)
Type: Polyclonal Antibody against Human TTC39C
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody is raised in rabbit against the human TTC39C protein. The antibody is affinity purified using the PrEST antigen as an affinity ligand.
Alternative Gene Names
C18orf17, FLJ33761, HsT2697
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | tetratricopeptide repeat domain 39C |
| Target Gene | TTC39C |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: INMLLNNGFRESDQLFKQYRNHSPLMSFGASFVSFLNAMMTFEEEKMQLACDDLKTTEKLCESEEAGVIETIKNKIKKNVDVRKSAPSMVDRLQ |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000024424 (98%), Rat ENSRNOG00000050949 (96%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



