CacheBy
Atlas Antibodies Anti-TTC39C Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TTC39C Antibody

상품 한눈에 보기

Human TTC39C 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC 응용에 적합. PrEST 항원으로 친화 정제됨. 높은 종 간 보존성(마우스 98%, 랫 96%)을 보임. 40% 글리세롤/PBS 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA065713-100 Anti-TTC39C Antibody, tetratricopeptide repeat domain 39C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065713-25 Anti-TTC39C Antibody, tetratricopeptide repeat domain 39C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TTC39C Antibody

Anti-TTC39C Antibody

Target: tetratricopeptide repeat domain 39C (TTC39C)
Type: Polyclonal Antibody against Human TTC39C


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is raised in rabbit against the human TTC39C protein. The antibody is affinity purified using the PrEST antigen as an affinity ligand.


Alternative Gene Names

C18orf17, FLJ33761, HsT2697

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein tetratricopeptide repeat domain 39C
Target Gene TTC39C
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
INMLLNNGFRESDQLFKQYRNHSPLMSFGASFVSFLNAMMTFEEEKMQLACDDLKTTEKLCESEEAGVIETIKNKIKKNVDVRKSAPSMVDRLQ
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000024424 (98%), Rat ENSRNOG00000050949 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.