CacheBy
Atlas Antibodies Anti-TTC39A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TTC39A Antibody

상품 한눈에 보기

Human TTC39A 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. Orthogonal validation으로 검증되었으며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응하며 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028098-100 Anti-TTC39A Antibody, tetratricopeptide repeat domain 39A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028098-25 Anti-TTC39A Antibody, tetratricopeptide repeat domain 39A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TTC39A Antibody

Anti-TTC39A Antibody

Target: tetratricopeptide repeat domain 39A (TTC39A)
Type: Polyclonal Antibody against Human TTC39A


  • IHC (Immunohistochemistry)
  • WB (Western Blot)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal antibody raised in rabbit against human TTC39A.


Alternative Gene Names

C1orf34, DEME-6, KIAA0452

Open Datasheet


Target Information

항목 내용
Target Protein tetratricopeptide repeat domain 39A
Target Gene TTC39A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence YFSSNPISLPVPALEMMYIWNGYAVIGKQPKLTDGILEIITKAEEMLEKGPENEYSVDDECLVKLLKGLCLKYLG
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000028555 (87%), Rat ENSRNOG00000047573 (85%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal
Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.