Atlas Antibodies Anti-TTC29 Antibody

상품 한눈에 보기

Human TTC29 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 인체 반응성이 검증되었으며, 안정적인 PBS/glycerol 버퍼에 보존됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA061473-100 Anti-TTC29 Antibody, tetratricopeptide repeat domain 29 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA061473-25 Anti-TTC29 Antibody, tetratricopeptide repeat domain 29 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: tetratricopeptide repeat domain 29
Supplier: Atlas Antibodies

면역조직화학 (IHC)

Polyclonal antibody against Human TTC29.

Target Protein: tetratricopeptide repeat domain 29
Target Gene: TTC29
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

IDCGKKEAEAHMHMGLLYEEDGQLLEAAEHYEAFHQLTQGRIWKDETGRSLNLLACESLLRTYRLLSDKMLENKEYKQAIKILIKA

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Rat	ENSRNOG00000012342	79%
Mouse	ENSMUSG00000037101	79%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification	Affinity purified using PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.