CacheBy
Atlas Antibodies Anti-TTC12 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TTC12 Antibody

상품 한눈에 보기

Human TTC12 단백질을 인식하는 폴리클로날 항체로, 면역조직화학(IHC)에 적합합니다. Rabbit 유래 IgG이며 PrEST 항원으로 친화 정제되었습니다. Human에 대해 검증되었으며, Rat 및 Mouse와 교차 반응성이 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038543-100 Anti-TTC12 Antibody, tetratricopeptide repeat domain 12 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038543-25 Anti-TTC12 Antibody, tetratricopeptide repeat domain 12 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TTC12 Antibody

Anti-TTC12 Antibody

Target: Tetratricopeptide repeat domain 12 (TTC12)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human TTC12 protein.
Validated for immunohistochemistry (IHC) applications.


Alternative Gene Names

FLJ13859, FLJ20535, TPARM

Open Datasheet (PDF)


Target Information

  • Target Protein: Tetratricopeptide repeat domain 12
  • Target Gene: TTC12
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
FLDFSDKEANTAMGLFTDLALEERFQVWFQANLPGVLPALTGVLKTDPKVSSSSALCQCIAIMGNLSAEPTTRRHMAACEEFGDGC

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000008595 81%
Mouse ENSMUSG00000040219 73%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Applications Immunohistochemistry (IHC)
Storage Notes Gently mix before use. Determine optimal concentrations and conditions experimentally.
Safety Material Safety Data Sheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.