CacheBy
Atlas Antibodies Anti-TTC12 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TTC12 Antibody

상품 한눈에 보기

Human TTC12 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산되었습니다. PrEST 항원을 이용해 친화 정제되었으며, IHC 등 다양한 연구용 응용에 적합합니다. Human에서 검증되었으며 Rat, Mouse에서도 높은 상동성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038542-100 Anti-TTC12 Antibody, tetratricopeptide repeat domain 12 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038542-25 Anti-TTC12 Antibody, tetratricopeptide repeat domain 12 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TTC12 Antibody

Anti-TTC12 Antibody

Target: tetratricopeptide repeat domain 12 (TTC12)
Supplier: Atlas Antibodies


면역조직화학(IHC) 등 다양한 연구용 응용에 적합합니다.


Product Description

Polyclonal antibody against human TTC12 protein.


Alternative Gene Names

FLJ13859, FLJ20535, TPARM

Open Datasheet (PDF)


Target Information

구분 내용
Target Protein tetratricopeptide repeat domain 12
Target Gene TTC12
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence FLDFSDKEANTAMGLFTDLALEERFQVWFQANLPGVLPALTGVLKTDPKVSSSSALCQCIAIMGNLSAEPTTRRHMAACEEFGDGC

Verified Species Reactivity

  • Human

Interspecies Information

유전자 ID 항원 서열 유사도
Rat ENSRNOG00000008595 81%
Mouse ENSMUSG00000040219 73%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도와 조건은 사용자가 실험 조건에 맞게 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.