Atlas Antibodies Anti-TSTA3 Antibody

상품 한눈에 보기

Human TSTA3 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC, WB(재조합 발현 검증), ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA023361-100 Anti-TSTA3 Antibody, tissue specific transplantation antigen P35B 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA023361-25 Anti-TSTA3 Antibody, tissue specific transplantation antigen P35B 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Tissue specific transplantation antigen P35B
Type: Polyclonal Antibody against Human TSTA3
Supplier: Atlas Antibodies

IHC (Immunohistochemistry)
WB (Western Blot) — Recombinant expression validation using target protein overexpression
ICC (Immunocytochemistry)

FX, P35B, SDR4E1

항목	내용
Target Protein	Tissue specific transplantation antigen P35B
Target Gene	TSTA3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	RILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTDTAQTRALFEKVQPTHVIHLAAMVG
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000009020 (92%), Mouse ENSMUSG00000022570 (92%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand