CacheBy
Atlas Antibodies Anti-TSSC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TSSC1 Antibody

상품 한눈에 보기

Human TSSC1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 WB에 추천. PrEST 항원을 이용해 친화 정제됨. Human에 대한 반응성 검증 완료. PBS와 글리세롤 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031234-100 Anti-TSSC1 Antibody, tumor suppressing subtransferable candidate 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031234-25 Anti-TSSC1 Antibody, tumor suppressing subtransferable candidate 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TSSC1 Antibody

Anti-TSSC1 Antibody

Tumor Suppressing Subtransferable Candidate 1 (TSSC1)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human TSSC1.

Open Datasheet

Target Information

  • Target Protein: Tumor suppressing subtransferable candidate 1
  • Target Gene: TSSC1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VILSNMVSISSEPFGHLVDDDDISDQEDHRSEEKSKEPLQDNVIATYEEHEDSVYAVDWSSADPWLFASLSYDGRLVINRVPRALKYH

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000009285 (92%)
  • Mouse ENSMUSG00000036613 (92%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.