CacheBy
Atlas Antibodies Anti-TSPYL4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TSPYL4 Antibody

상품 한눈에 보기

Human TSPYL4 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 및 Western Blot에 적합. PrEST 항원을 이용해 Affinity 정제됨. 높은 종간 반응 특이성을 가지며 안정적인 PBS/glycerol buffer에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044863-100 Anti-TSPYL4 Antibody, TSPY-like 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044863-25 Anti-TSPYL4 Antibody, TSPY-like 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TSPYL4 Antibody

Anti-TSPYL4 Antibody

Target Information

  • Target Protein: TSPY-like 4
  • Target Gene: TSPYL4
  • Alternative Gene Names: dJ486I3.2, KIAA0721
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human TSPYL4.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MIPGKKAKEVTTKKRAISAAVEKEGEAGAAMEEKKVVQKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNA

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000039485): 81%
  • Rat (ENSRNOG00000000547): 79%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.