CacheBy
Atlas Antibodies Anti-TSPAN2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TSPAN2 Antibody

상품 한눈에 보기

Human TSPAN2 단백질을 인식하는 Rabbit Polyclonal 항체로 IHC 및 ICC에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증되었으며, 쥐 및 생쥐와 높은 서열 유사성을 가짐. 40% glycerol과 PBS buffer로 안정화.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA015640-100 Anti-TSPAN2 Antibody, tetraspanin 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015640-25 Anti-TSPAN2 Antibody, tetraspanin 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TSPAN2 Antibody

Anti-TSPAN2 Antibody

Target: tetraspanin 2
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TSPAN2.

Alternative Gene Names

FLJ12082, TSN2, TSPAN-2

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein tetraspanin 2
Target Gene TSPAN2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VAIRHVQTMYEEAYNDYLKDRGKGNGTLITFHSTFQCCGKESSEQVQPTCPKELLGHKNCIDEIETIISVKLQ
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000023338 (89%), Mouse ENSMUSG00000027858 (88%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.