CacheBy
Atlas Antibodies Anti-TSPAN11 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TSPAN11 Antibody

상품 한눈에 보기

Human TSPAN11 단백질을 인식하는 폴리클론 항체로 WB 및 ICC에 적합. Rabbit 유래 IgG 형식이며 PrEST 항원으로 친화 정제됨. 40% 글리세롤/PBS 버퍼에 보존제로 sodium azide 포함. 인간 반응성 검증 완료.

카탈로그번호
HPA066789-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA066789-100 Anti-TSPAN11 Antibody, tetraspanin 11 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066789-25 Anti-TSPAN11 Antibody, tetraspanin 11 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TSPAN11 Antibody

Anti-TSPAN11 Antibody

Target Information

  • Target Protein: tetraspanin 11
  • Target Gene: TSPAN11
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    RLSDELKQHLNRTLAENYGQPGATQITASVDRLQQDFKCCGSN

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000054360 (84%)
  • Mouse ENSMUSG00000030351 (84%)

Product Description

Polyclonal antibody against Human TSPAN11.

  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet
Material Safety Data Sheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.