CacheBy
Atlas Antibodies Anti-GPRIN2 Antibody
원본

Atlas Antibodies Anti-GPRIN2 Antibody

상품 한눈에 보기

Human GPRIN2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 실험에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038129-100 Anti-GPRIN2 Antibody, G protein regulated inducer of neurite outgrowth 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038129-25 Anti-GPRIN2 Antibody, G protein regulated inducer of neurite outgrowth 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GPRIN2 Antibody

Anti-GPRIN2 Antibody

G protein regulated inducer of neurite outgrowth 2 (GPRIN2)
Polyclonal antibody against Human GPRIN2


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody targeting the human GPRIN2 protein, a G protein regulated inducer of neurite outgrowth.


Alternative Gene Names

  • KIAA0514
  • MGC15171

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein G protein regulated inducer of neurite outgrowth 2
Target Gene GPRIN2
Verified Species Reactivity Human
Interspecies Identity Mouse (73%), Rat (68%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QAEPKAAEQLATTTCHALPPAALLCGMREMREVGAGGCCHALPATGILAFPKLVASVSESGLQAQHGVKIHCRL

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.