AI 생성

1 / 2

Atlas Antibodies Anti-GPRC5C Antibody

상품 한눈에 보기

Human GPRC5C 단백질을 인식하는 Rabbit Polyclonal 항체. IHC 및 WB 실험에 적합하며 RNA-seq 데이터 기반 Orthogonal Validation 제공. 고순도 Affinity 정제 항체로 높은 특이성과 재현성 보장.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029776-100 Anti-GPRC5C Antibody, G protein-coupled receptor, class C, group 5, member C 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029776-25 Anti-GPRC5C Antibody, G protein-coupled receptor, class C, group 5, member C 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

G protein-coupled receptor, class C, group 5, member C

Immunohistochemistry (IHC)
Western Blot (WB)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal Antibody against Human GPRC5C

RAIG-3

항목	내용
Target Protein	G protein-coupled receptor, class C, group 5, member C
Target Gene	GPRC5C
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Homology	Mouse (91%), Rat (90%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

TSVYQPTEMALMHKVPSEGAYDIILPRATANSQVMGSANSTLRAEDMYSAQSHQAATPPKDGKNSQVFRN

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
Western Blot

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.