AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GPR82 Antibody
상품 한눈에 보기
Human GPR82 단백질을 인식하는 폴리클로날 항체로, 토끼에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. PBS와 글리세롤 완충액에 보존되어 안정적 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA035914-100 Anti-GPR82 Antibody, G protein-coupled receptor 82 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035914-25 Anti-GPR82 Antibody, G protein-coupled receptor 82 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GPR82 Antibody
Anti-GPR82 Antibody
Target Information
- Target Protein: G protein-coupled receptor 82
- Target Gene: GPR82
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
AISRYATLMQKDSSQETTSCYEKIFYGHLLKKFRQPNFAR
Product Description
Polyclonal antibody against human GPR82.
Recommended Applications
- Immunohistochemistry (IHC)
Species Reactivity
- Verified Reactivity: Human
- Interspecies Information:
- Rat ENSRNOG00000039762 (83%)
- Mouse ENSMUSG00000047678 (80%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.