Atlas Antibodies Anti-GPR161 Antibody

상품 한눈에 보기

Human GPR161을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC 등 다양한 응용에 적합함. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 서열 일치율을 보임. 안정적인 PBS/glycerol buffer에 보존되어 연구용으로 최적화됨.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA015576-100 Anti-GPR161 Antibody, G protein-coupled receptor 161 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA015576-25 Anti-GPR161 Antibody, G protein-coupled receptor 161 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GPR161 Antibody

Anti-GPR161 Antibody

Target Information

Target Protein: G protein-coupled receptor 161
Target Gene: GPR161
Alternative Gene Names: RE2

Product Description

Polyclonal antibody against human GPR161, produced in rabbit and affinity purified using a recombinant PrEST antigen.

Recommended Applications

면역조직화학(IHC) 등 다양한 연구 응용에 적합합니다.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLDSYAASLAKAIEAEAKINLFGEEALPGVLVTARTVPGGGFGGRRGSRTLVSQRLQLQSIEEGDVLA

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Mouse	ENSMUSG00000040836	93%
Rat	ENSRNOG00000003073	92%

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet