Atlas Antibodies Anti-GPR143 Antibody

상품 한눈에 보기

Human GPR143 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 RNA-seq 비교를 통한 Orthogonal Validation 완료. PrEST 항원으로 친화 정제된 고품질 항체로 인체 시료에 적합. OA1 유전자 대응.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA003648-100 Anti-GPR143 Antibody, G protein-coupled receptor 143 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA003648-25 Anti-GPR143 Antibody, G protein-coupled receptor 143 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

G protein-coupled receptor 143 (GPR143)
Polyclonal Antibody against Human GPR143

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

항목	내용
Target Protein	G protein-coupled receptor 143
Target Gene	GPR143
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000025333 (55%), Rat ENSRNOG00000003543 (55%)

Antigen Sequence:
CSLGFQSPRKEIQWESLTTSAAEGAHPSPLMPHENPASGKVSQVGGQTSDEALSMLSEGSDASTIEIHTASESCNKNEGDPALPT

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)