CacheBy
Atlas Antibodies Anti-GPAA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GPAA1 Antibody

상품 한눈에 보기

Human GPAA1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 보존성을 보입니다. 40% 글리세롤/PBS 완충액에 보존제로 아지드가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA077224-100 Anti-GPAA1 Antibody, glycosylphosphatidylinositol anchor attachment 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077224-25 Anti-GPAA1 Antibody, glycosylphosphatidylinositol anchor attachment 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GPAA1 Antibody

Anti-GPAA1 Antibody

Target: glycosylphosphatidylinositol anchor attachment 1 (GPAA1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human GPAA1.


Alternative Gene Names

GAA1, hGAA1

Open Datasheet (PDF)


Target Information

  • Target Protein: glycosylphosphatidylinositol anchor attachment 1
  • Target Gene: GPAA1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MQSSPLQGRAGAIQAAVALELSSDVVTSLDVAVEGLNGQLPNLDLLNLFQTFCQKGGLLCTLQGKLQPEDWTSLDGPL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000029280 95%
Mouse ENSMUSG00000022561 95%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.