CacheBy
Atlas Antibodies Anti-GOPC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GOPC Antibody

상품 한눈에 보기

Human GOPC 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다. GOPC 관련 세포 소기관 연구에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA019477-100 Anti-GOPC Antibody, golgi-associated PDZ and coiled-coil motif containing 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019477-25 Anti-GOPC Antibody, golgi-associated PDZ and coiled-coil motif containing 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GOPC Antibody

Anti-GOPC Antibody

golgi-associated PDZ and coiled-coil motif containing

  • IHC (Immunohistochemistry)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human GOPC.

Alternative Gene Names

CAL, dJ94G16.2, FIG, GOPC1, PIST

Open Datasheet

Target Information

항목 내용
Target Protein golgi-associated PDZ and coiled-coil motif containing
Target Gene GOPC
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQ
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000019861 (100%), Rat ENSRNOG00000000408 (98%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.