Atlas Antibodies Anti-GOLGA2 Antibody

상품 한눈에 보기

Human GOLGA2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal 및 Independent validation을 통해 신뢰성 검증 완료. GM130(golgin-95)로도 알려진 단백질 타깃.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA021799-100 Anti-GOLGA2 Antibody, golgin A2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA021799-25 Anti-GOLGA2 Antibody, golgin A2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: golgin A2
Alternative Gene Names: GM130, golgin-95

Polyclonal antibody against human GOLGA2.
Validated for multiple applications including IHC, WB, and ICC.

IHC Orthogonal Validation:
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Independent Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC:
Suitable for immunocytochemistry applications.

항목	내용
Target Protein	golgin A2
Target Gene	GOLGA2
Alternative Names	GM130, golgin-95
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKE
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000011884 (79%), Mouse ENSMUSG00000002546 (78%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Storage Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.