
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GOLGA2 Antibody
상품 한눈에 보기
Human GOLGA2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal 및 Independent validation을 통해 신뢰성 검증 완료. GM130(golgin-95)로도 알려진 단백질 타깃.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA021799-100 Anti-GOLGA2 Antibody, golgin A2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021799-25 Anti-GOLGA2 Antibody, golgin A2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GOLGA2 Antibody
Anti-GOLGA2 Antibody
Target Protein: golgin A2
Alternative Gene Names: GM130, golgin-95
Product Description
Polyclonal antibody against human GOLGA2.
Validated for multiple applications including IHC, WB, and ICC.
Recommended Applications
IHC Orthogonal Validation:
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Independent Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.ICC:
Suitable for immunocytochemistry applications.
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | golgin A2 |
| Target Gene | GOLGA2 |
| Alternative Names | GM130, golgin-95 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: GDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKE |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000011884 (79%), Mouse ENSMUSG00000002546 (78%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
Additional Information
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



